DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and Sox15

DIOPT Version :10

Sequence 1:NP_726109.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_033261.1 Gene:Sox15 / 20670 MGIID:98363 Length:231 Species:Mus musculus


Alignment Length:99 Identity:29/99 - (29%)
Similarity:48/99 - (48%) Gaps:20/99 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSE----WEAKAAKAK--- 60
            :|.|||::|:|:|.:..|..:.::||.:..:|::||.|..|:.:.|:.:    .|||..:|:   
Mouse    45 EKVKRPMNAFMVWSSVQRRQMAQQNPKMHNSEISKRLGAQWKLLGDEEKRPFVEEAKRLRARHLR 109

  Fly    61 --DDYD----RAVKE-------FEANGGSSAANG 81
              .||.    |..|.       |...||..|..|
Mouse   110 DYPDYKYRPRRKSKNSSTGSVPFSQEGGGLACGG 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_726109.1 HMG-box_SSRP1-like 7..71 CDD:438810 22/83 (27%)
Sox15NP_033261.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 29/99 (29%)
Required to promote HAND1 transcriptional activator activity. /evidence=ECO:0000269|PubMed:16759287 1..45 29/99 (29%)
HMG-box_SoxA_SoxB_SoxG 46..121 CDD:438837 22/74 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..136 5/24 (21%)
Interaction with FHL3. /evidence=ECO:0000269|PubMed:17363903 136..181 4/8 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..231
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.