DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and egl-13

DIOPT Version :10

Sequence 1:NP_726109.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001024918.1 Gene:egl-13 / 180833 WormBaseID:WBGene00001182 Length:470 Species:Caenorhabditis elegans


Alignment Length:46 Identity:13/46 - (28%)
Similarity:25/46 - (54%) Gaps:0/46 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSE 51
            |||::|:|:|....|..|.:..|.:..:.::|..|..|:.|.:..:
 Worm   330 KRPMNAFMVWARDERRKILKAYPDMHNSNISKILGSRWKGMSNSEK 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_726109.1 HMG-box_SSRP1-like 7..71 CDD:438810 12/45 (27%)
egl-13NP_001024918.1 HMG-box_EGL13-like 327..404 CDD:438848 13/46 (28%)

Return to query results.
Submit another query.