DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment HmgD and hmg-4

DIOPT Version :9

Sequence 1:	NP_001163244.1	Gene:	HmgD / 37481	FlyBaseID:	FBgn0004362	Length:	112	Species:	Drosophila melanogaster
Sequence 2:	NP_498633.1	Gene:	hmg-4 / 176052	WormBaseID:	WBGene00001974	Length:	697	Species:	Caenorhabditis elegans

Alignment Length:	141	Identity:	47/141 - (33%)
Similarity:	68/141 - (48%)	Gaps:	35/141 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly     5 PKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMK--DKSEWEAKAAKAKDDYDRAV 67
            |||..||||.|..::|..:|.:  |..|.:|||:||..|:.|.  ||.:||.||.:.|..|::.:
Worm   556 PKRATSAYMQWFLASRNELKED--GDSVADVAKKGGAKWKTMSSDDKKKWEEKAEEDKSRYEKEM 618

  Fly    68 KEFEANGGSSAANGGGAKKRAK--------------------------PAKKVAKKSKKEESDE- 105
            ||:..||..|:::...:.|.:|                          |.||..|.:.||||:|
Worm   619 KEYRKNGPPSSSSKPSSSKTSKKSSGPSSSKAISKEYISDSDDSDDEEPKKKEKKAAPKEESEES 683

  Fly   106 ----DDDDESE 112
                |..|||:
Worm   684 NNGSDGSDESD 694

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
HmgD	NP_001163244.1	HMGB-UBF_HMG-box	5..68	CDD:238686	27/64 (42%)
hmg-4	NP_498633.1	SSrecog	75..285	CDD:281523
		PH2_SSRP1-like	332..429	CDD:270051
		HMGB-UBF_HMG-box	556..619	CDD:238686	27/64 (42%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C160160102
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930