DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and hmg-1.2

DIOPT Version :10

Sequence 1:NP_726109.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001380090.1 Gene:hmg-1.2 / 175890 WormBaseID:WBGene00001972 Length:235 Species:Caenorhabditis elegans


Alignment Length:105 Identity:27/105 - (25%)
Similarity:48/105 - (45%) Gaps:22/105 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAM--KDKSEWEAKAAKAKDDYDRAV 67
            |||.|||:..:....|..|:..:|..||.:||:..|::|:.:  :.|..:|.||...||.|...:
 Worm   135 PKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEM 199

  Fly    68 KEFEANGGSSAANGGGAKKRAKPAKKVAKKSKKEESDEDD 107
            :.::|                    ::.|.|..:..|:|:
 Worm   200 RNYKA--------------------EMQKMSGMDHYDDDN 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_726109.1 HMG-box_SSRP1-like 7..71 CDD:438810 20/65 (31%)
hmg-1.2NP_001380090.1 HMG-box_HMGB_rpt1 44..112 CDD:438794
HMG-box_SF 124..202 CDD:469606 22/66 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.