DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and Hmg20b

DIOPT Version :10

Sequence 1:NP_726109.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001415470.1 Gene:Hmg20b / 15353 MGIID:1341190 Length:415 Species:Mus musculus


Alignment Length:101 Identity:30/101 - (29%)
Similarity:46/101 - (45%) Gaps:12/101 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMK--DKSEWEAKAAKAKDDYDRAV 67
            ||.|::.|:.:||..||.|:..:|.:...|:.|..|..|..::  :|..:..:|.|.|..|   :
Mouse    70 PKAPVTGYVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPAEKQRYLDEAEKEKQQY---L 131

  Fly    68 KEFEANGGSSAANGGGAKKRAKPAKKVAKKSKKEES 103
            ||..|...|.|       .:....|....|.|||:|
Mouse   132 KELWAYQQSEA-------YKVCTEKIQENKIKKEDS 160

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_726109.1 HMG-box_SSRP1-like 7..71 CDD:438810 19/65 (29%)