DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and Hmgb1

DIOPT Version :10

Sequence 1:NP_726109.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_034569.1 Gene:Hmgb1 / 15289 MGIID:96113 Length:215 Species:Mus musculus


Alignment Length:110 Identity:45/110 - (40%)
Similarity:67/110 - (60%) Gaps:7/110 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWR--AMKDKSEWEAKAAKAKDDYDRAV 67
            ||||.||:.|:.:..|..||.|:||:.:.:|||:.||:|.  |..||..:|.||||.|:.|::.:
Mouse    95 PKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDI 159

  Fly    68 KEFEANGGSSAANGGGAKKRAKPAKKVAKKSKKEESDEDDDDESE 112
            ..:.|.|...||..|..|     |:|..||.::|:.:||::||.|
Mouse   160 AAYRAKGKPDAAKKGVVK-----AEKSKKKKEEEDDEEDEEDEEE 199

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_726109.1 HMG-box_SSRP1-like 7..71 CDD:438810 27/65 (42%)
Hmgb1NP_034569.1 Sufficient for interaction with HAVCR2. /evidence=ECO:0000269|PubMed:22842346 1..97 1/1 (100%)
LPS binding (delipidated). /evidence=ECO:0000250|UniProtKB:P09429 3..15
HMG-box_HMGB_rpt1 8..76 CDD:438794
NLS 1. /evidence=ECO:0000250|UniProtKB:P63159 27..43
Nuclear localization signal (NLS) 1. /evidence=ECO:0000250|UniProtKB:P63159 27..43
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..95 45/110 (41%)