DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and Ssrp

DIOPT Version :10

Sequence 1:NP_726109.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:XP_320213.4 Gene:Ssrp / 1280366 VectorBaseID:AGAMI1_014024 Length:728 Species:Anopheles gambiae


Alignment Length:114 Identity:53/114 - (46%)
Similarity:79/114 - (69%) Gaps:6/114 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEWEAKAAKAKDDYDRAVKE 69
            ||||.:|:||::|::||.||::.||:.:||::|:|||||:.:|||.|||||||||||||..|:..
Mosquito   567 PKRPSTAFMLFMNASREQIKKDFPGLSITEMSKKGGELWKELKDKKEWEAKAAKAKDDYTEAMAA 631

  Fly    70 FEANGGSSAANGGGAKKRAKPAKKVAKKS------KKEESDEDDDDESE 112
            ::|:||.:.....|.|::...|||.:..:      |.:|..|.||..|:
Mosquito   632 WKASGGGTDGGDKGEKRKKSTAKKSSDSAMKGSGFKSKEFIEGDDSSSD 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_726109.1 HMG-box_SSRP1-like 7..71 CDD:438810 37/63 (59%)
SsrpXP_320213.4 POB3 20..494 CDD:227494
HMG-box_SSRP1-like 569..633 CDD:438810 37/63 (59%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.