powered by:
Protein Alignment HmgD and HMGB4
DIOPT Version :9
Sequence 1: | NP_001163244.1 |
Gene: | HmgD / 37481 |
FlyBaseID: | FBgn0004362 |
Length: | 112 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001366230.1 |
Gene: | HMGB4 / 127540 |
HGNCID: | 24954 |
Length: | 186 |
Species: | Homo sapiens |
Alignment Length: | 62 |
Identity: | 21/62 - (33%) |
Similarity: | 34/62 - (54%) |
Gaps: | 2/62 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 KPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKD--KSEWEAKAAKAKDDY 63
:|:||.|:::|:.......:|||||...|.:|||..|::|....| |..:|.:.|..:..|
Human 92 EPRRPPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQRVALLRAKY 153
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1641977at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000133 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR48112 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
4 | 4.020 |
|
Return to query results.
Submit another query.