DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and LOC108350839

DIOPT Version :9

Sequence 1:NP_001163244.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:XP_017448593.1 Gene:LOC108350839 / 108350839 RGDID:11440908 Length:214 Species:Rattus norvegicus


Alignment Length:109 Identity:47/109 - (43%)
Similarity:67/109 - (61%) Gaps:8/109 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELW--RAMKDKSEWEAKAAKAKDDYDRAVK 68
            |||.||:.|:.:..|..||.|:||:.:.:|||:.||:|  .|:.||...|.||||.|:.|::.:.
  Rat    96 KRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWTNTAVDDKQPCEKKAAKLKEKYEKDIA 160

  Fly    69 EFEANGGSSAANGGGAKKRAKPAKKVAKKSKKEESDEDDDDESE 112
            .:.|.|...||..|..|     |:| :||.|:||.||:|:||.|
  Rat   161 AYRAKGKPDAAKKGVVK-----AEK-SKKKKEEEDDEEDEDEEE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_001163244.1 HMGB-UBF_HMG-box 5..68 CDD:238686 28/63 (44%)
LOC108350839XP_017448593.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100324
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.