DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and HMG20B

DIOPT Version :9

Sequence 1:NP_001163244.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_006330.2 Gene:HMG20B / 10362 HGNCID:5002 Length:317 Species:Homo sapiens


Alignment Length:101 Identity:30/101 - (29%)
Similarity:47/101 - (46%) Gaps:12/101 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMK--DKSEWEAKAAKAKDDYDRAV 67
            ||.|::.|:.:||..||.|:..:|.:...|:.|..|..|..::  :|..:..:|.:.|..|   :
Human    70 PKAPVTGYVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPTEKQRYLDEAEREKQQY---M 131

  Fly    68 KEFEANGGSSAANGGGAKKRAKPAKKVAKKSKKEES 103
            ||..|...|.|       .:....|...||.|||:|
Human   132 KELRAYQQSEA-------YKMCTEKIQEKKIKKEDS 160

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_001163244.1 HMGB-UBF_HMG-box 5..68 CDD:238686 18/64 (28%)