powered by:
Protein Alignment HmgD and bbx
DIOPT Version :9
Sequence 1: | NP_001163244.1 |
Gene: | HmgD / 37481 |
FlyBaseID: | FBgn0004362 |
Length: | 112 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002932333.2 |
Gene: | bbx / 100487237 |
XenbaseID: | XB-GENE-981428 |
Length: | 962 |
Species: | Xenopus tropicalis |
Alignment Length: | 72 |
Identity: | 19/72 - (26%) |
Similarity: | 36/72 - (50%) |
Gaps: | 4/72 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 KPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEWEAKAAKAKDDYDRAVK 68
:.:||::|::|:....|..:::|:|.:......|...:.| |..|.:|.:.....||:..|..:|
Frog 140 RARRPMNAFLLFCKRHRSLVRQEHPRLDNRGATKILADWW-AYLDPNEKQKYTDMAKEYKDAFMK 203
Fly 69 EFEANGG 75
||.|
Frog 204 ---ANPG 207
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1641977at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.