DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgD and sox18

DIOPT Version :10

Sequence 1:NP_726109.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001123409.1 Gene:sox18 / 100170185 XenbaseID:XB-GENE-483233 Length:362 Species:Xenopus tropicalis


Alignment Length:101 Identity:24/101 - (23%)
Similarity:46/101 - (45%) Gaps:19/101 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DKP-----KRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWR----AMKDKSEWEAKAAK 58
            :||     :||::|:|:|....|:.:.::||.:....::|..|:.|:    |.|.....||:..:
 Frog    61 EKPGDPRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGQSWKNLSSAEKRPFVEEAERLR 125

  Fly    59 AKDDYDRAVKEFEANGGSSAANGGGAKKRAKPAKKV 94
            .:...|....::...          .||:||..|:|
 Frog   126 VQHLQDHPNYKYRPR----------RKKQAKKLKRV 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgDNP_726109.1 HMG-box_SSRP1-like 7..71 CDD:438810 16/67 (24%)
sox18NP_001123409.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..68 2/6 (33%)
HMG-box_SoxF_SOX18 65..144 CDD:438851 17/88 (19%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P43680 70..83 5/12 (42%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P43680 94..106 2/11 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..159 7/33 (21%)
Important for transcriptional activation. /evidence=ECO:0000250|UniProtKB:P43680 149..209 2/3 (67%)
Sox17_18_mid 173..222 CDD:463454
9aaTAD. /evidence=ECO:0000250|UniProtKB:P35713 307..315
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.