DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and AT1G76110

DIOPT Version :10

Sequence 1:NP_726106.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_177738.1 Gene:AT1G76110 / 843943 AraportID:AT1G76110 Length:338 Species:Arabidopsis thaliana


Alignment Length:68 Identity:19/68 - (27%)
Similarity:32/68 - (47%) Gaps:3/68 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEYNKAV 68
            ||...|.|..:..|...::|...| :|..:..|..||.|..|  :::..::...:|.||.|.:.:
plant   255 PKPNRSGYNFFFAEKHCKLKSLYP-NKEREFTKLIGESWSNLSTEERMVYQDIGLKDKERYQREL 318

  Fly    69 KEY 71
            .||
plant   319 NEY 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_726106.1 HMG-box_SSRP1-like 8..72 CDD:438810 17/66 (26%)
AT1G76110NP_177738.1 ARID_HMGB9-like 40..125 CDD:350636
HMG-box_AtHMGB9-like 255..321 CDD:438825 17/66 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.