powered by:
Protein Alignment HmgZ and HMGB3
DIOPT Version :9
Sequence 1: | NP_001286694.1 |
Gene: | HmgZ / 37480 |
FlyBaseID: | FBgn0010228 |
Length: | 111 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001031075.1 |
Gene: | HMGB3 / 838659 |
AraportID: | AT1G20696 |
Length: | 147 |
Species: | Arabidopsis thaliana |
Alignment Length: | 71 |
Identity: | 28/71 - (39%) |
Similarity: | 43/71 - (60%) |
Gaps: | 3/71 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 DRPKRPLSAYMLWLNETREQIKKDNPGSK-VTDIAKRGGELWRGLKD--KTEWEQKAIKMKEEYN 65
::||||.||:.:::.:.|...|:::|.:| |..:.|.|||.|:.|.| |..:..||.|.|.||.
plant 33 NKPKRPSSAFFVFMEDFRVTYKEEHPKNKSVAAVGKAGGEKWKSLSDSEKAPYVAKADKRKVEYE 97
Fly 66 KAVKEY 71
|.:|.|
plant 98 KNMKAY 103
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
57 |
1.000 |
Domainoid score |
I3986 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
69 |
1.000 |
Inparanoid score |
I2470 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1641977at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000133 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm3241 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
7 | 6.870 |
|
Return to query results.
Submit another query.