DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and HMGB2

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_564123.1 Gene:HMGB2 / 838658 AraportID:AT1G20693 Length:144 Species:Arabidopsis thaliana


Alignment Length:112 Identity:40/112 - (35%)
Similarity:65/112 - (58%) Gaps:9/112 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DRPKRPLSAYMLWLNETREQIKKDNPGSK-VTDIAKRGGELWRGLKD--KTEWEQKAIKMKEEYN 65
            ::||||.||:.:::.:.||..||:||.:| |..:.|..|:.|:.|.|  |..:..||.|.|.||.
plant    36 NKPKRPASAFFVFMEDFRETFKKENPKNKSVATVGKAAGDKWKSLSDSEKAPYVAKAEKRKVEYE 100

  Fly    66 KAVKEYEANGGTDSGAPKKRK---KAAAKPAKKAKKKESSEEEEEDE 109
            |.:|.|  |...:.| ||:.:   |:.::...:...::.|||||:|:
plant   101 KNIKAY--NKKLEEG-PKEDEESDKSVSEVNDEDDAEDGSEEEEDDD 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 28/67 (42%)
HMGB2NP_564123.1 HMG_box 38..106 CDD:395407 28/67 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I3986
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I2470
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 1 1.000 - - otm3241
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.