DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and 3xHMG-box2

DIOPT Version :10

Sequence 1:NP_726106.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_194111.1 Gene:3xHMG-box2 / 828480 AraportID:AT4G23800 Length:456 Species:Arabidopsis thaliana


Alignment Length:122 Identity:37/122 - (30%)
Similarity:70/122 - (57%) Gaps:18/122 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLKDKTE--WEQKAIKMKEEYNKA 67
            :||.|:||::::.||.|..::::|  ..|.::||..||.|:.|.||.:  :|:.|.|.||.|.:|
plant   254 KPKHPVSAFLVYANERRAALREEN--KSVVEVAKITGEEWKNLSDKKKAPYEKVAKKNKETYLQA 316

  Fly    68 VKEYEANGGTDSGAPKK--------RKKAAAKPAKKAK------KKESSEEEEEDES 110
            ::||:.....::.:.||        .|:.|.:..||.:      |||.:.:::::|:
plant   317 MEEYKRTKEEEALSQKKEEEELLKLHKQEALQMLKKKEKTDNLIKKEKATKKKKNEN 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_726106.1 HMG-box_SSRP1-like 8..72 CDD:438810 24/65 (37%)
3xHMG-box2NP_194111.1 PTZ00121 <2..454 CDD:173412 37/122 (30%)
HMG-box_AtHMGB6-like_rpt1 139..206 CDD:438822
HMG-box_AtHMGB6-like_rpt2 255..320 CDD:438823 25/66 (38%)
HMG-box_AtHMGB6-like_rpt3 371..447 CDD:438824 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.