DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and 3xHMG-box1

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_192846.1 Gene:3xHMG-box1 / 826709 AraportID:AT4G11080 Length:446 Species:Arabidopsis thaliana


Alignment Length:124 Identity:36/124 - (29%)
Similarity:68/124 - (54%) Gaps:20/124 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLKD--KTEWEQKAIKMKEEYNKA 67
            :||:|:|||:::.||.|..:|.:|  ..|.::||..||.|:.|.:  |..::|.|.|.||.|.:.
plant   245 KPKQPISAYLIYANERRAALKGEN--KSVIEVAKMAGEEWKNLSEEKKAPYDQMAKKNKEIYLQE 307

  Fly    68 VKEYEANGGTDSGAPKK--------RKKAAAKPAKKAKK--------KESSEEEEEDES 110
            ::.|:.....::.:.||        .|:.|.:..||.:|        ||:::.::::|:
plant   308 MEGYKRTKEEEAMSQKKEEEEFMKLHKQEALQLLKKKEKTDNIIKKTKETAKNKKKNEN 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 25/66 (38%)
3xHMG-box1NP_192846.1 HMGB-UBF_HMG-box 130..193 CDD:238686
HMGB-UBF_HMG-box 246..309 CDD:238686 25/64 (39%)
HMGB-UBF_HMG-box 372..437 CDD:238686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.