DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment HmgZ and HMG

DIOPT Version :9

Sequence 1:	NP_001286694.1	Gene:	HmgZ / 37480	FlyBaseID:	FBgn0010228	Length:	111	Species:	Drosophila melanogaster
Sequence 2:	NP_189515.1	Gene:	HMG / 822505	AraportID:	AT3G28730	Length:	646	Species:	Arabidopsis thaliana

Alignment Length:	82	Identity:	26/82 - (31%)
Similarity:	42/82 - (51%)	Gaps:	8/82 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly     6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLK--DKTEWEQKAIKMKEEYNKAV 68
            |||.:|.:|.:....|:.|||::||....::.|..|:.||.:.  ||..:|.||...|:.|...:
plant   562 PKRAMSGFMFFSQMERDNIKKEHPGIAFGEVGKVLGDKWRQMSADDKEPYEAKAQVDKQRYKDEI 626

  Fly    69 KEYE------ANGGTDS 79
            .:|:      .:.|.||
plant   627 SDYKNPQPMNVDSGNDS 643

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
HmgZ	NP_001286694.1	HMG_box	6..71	CDD:395407	22/66 (33%)
HMG	NP_189515.1	POB3	7..440	CDD:227494
HMG	NP_189515.1	HMGB-UBF_HMG-box	564..627	CDD:238686	20/62 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910