DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and AT3G13350

DIOPT Version :10

Sequence 1:NP_726106.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_566454.1 Gene:AT3G13350 / 820535 AraportID:AT3G13350 Length:319 Species:Arabidopsis thaliana


Alignment Length:79 Identity:22/79 - (27%)
Similarity:39/79 - (49%) Gaps:5/79 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEYNKA 67
            :||...|.|..:..|...::|.:..|.: ..|.|:.|.:|..|  .:|..::.|.:|..|.|...
plant   237 KPKCHRSGYNFFFAEQYARLKPEYHGQE-RSITKKIGHMWSNLTESEKQVYQDKGVKDVERYRIE 300

  Fly    68 VKEYEANGGTDSGA 81
            :.||:::  .:|||
plant   301 MLEYKSS--HESGA 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_726106.1 HMG-box_SSRP1-like 8..72 CDD:438810 16/65 (25%)
AT3G13350NP_566454.1 ARID_HMGB9-like 42..127 CDD:350636
HMG-box_AtHMGB9-like 238..304 CDD:438825 17/66 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.