DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and AT2G34450

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001031480.1 Gene:AT2G34450 / 818008 AraportID:AT2G34450 Length:152 Species:Arabidopsis thaliana


Alignment Length:110 Identity:29/110 - (26%)
Similarity:54/110 - (49%) Gaps:24/110 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PKRPLSAYMLWLNETREQIKKDNPGSKVTD--IAKRGGELWRGL--KDKTEWEQKAIKMKEEYNK 66
            ||:|.:|:..:|::.|:|.:::||..|...  |.|..||.|:.:  ::|.::...|.:.:||:::
plant    63 PKKPATAFFFFLDDFRKQYQEENPDVKSMREVIGKTCGEKWKTMTYEEKVKYYDIATEKREEFHR 127

  Fly    67 AVKEYEANGGTDSGAPKKRKKAAAKPAKKAKKKESSEEEEEDESE 111
            |:.||           .||.::.|         ....|.:.|.||
plant   128 AMTEY-----------TKRMESGA---------HDESETDSDYSE 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 20/68 (29%)
AT2G34450NP_001031480.1 HMGB-UBF_HMG-box 63..129 CDD:238686 19/65 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I3986
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I2470
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 1 1.000 - - otm3241
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.