| Sequence 1: | NP_726106.1 | Gene: | HmgZ / 37480 | FlyBaseID: | FBgn0010228 | Length: | 111 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_008760215.3 | Gene: | Ssrp1 / 81785 | RGDID: | 621143 | Length: | 802 | Species: | Rattus norvegicus |
| Alignment Length: | 146 | Identity: | 55/146 - (37%) |
|---|---|---|---|
| Similarity: | 77/146 - (52%) | Gaps: | 42/146 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEYNKAV 68
Fly 69 KEYEANGGTDS--GAPKKRKKAAAKPAKKA----------------------------------- 96
Fly 97 ---KKKESSEEEEEDE 109 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| HmgZ | NP_726106.1 | HMG-box_SSRP1-like | 8..72 | CDD:438810 | 35/65 (54%) |
| Ssrp1 | XP_008760215.3 | POB3 | 114..573 | CDD:227494 | |
| HMG-box_SSRP1-like | 642..708 | CDD:438810 | 35/65 (54%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||