powered by:
Protein Alignment HmgZ and UBTF
DIOPT Version :9
Sequence 1: | NP_001286694.1 |
Gene: | HmgZ / 37480 |
FlyBaseID: | FBgn0010228 |
Length: | 111 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016880484.1 |
Gene: | UBTF / 7343 |
HGNCID: | 12511 |
Length: | 781 |
Species: | Homo sapiens |
Alignment Length: | 104 |
Identity: | 25/104 - (24%) |
Similarity: | 48/104 - (46%) |
Gaps: | 18/104 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 DRPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLKDKTEWEQKAIKMKEEYNKAV 68
::||||:||..::..|.|.|::::.|....:::.:....:|..|.:|.:.:.|| :|...||.
Human 405 EKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKKAKYKA---REAALKAQ 466
Fly 69 KEYEANGGTDSGAPKKRKKAAAKPAKKAKKKESSEEEEE 107
.| :|...:..::.|..||.:..||
Human 467 SE---------------RKPGGEREERGKLPESPKRAEE 490
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
HmgZ | NP_001286694.1 |
HMG_box |
6..71 |
CDD:395407 |
18/64 (28%) |
UBTF | XP_016880484.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.