DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and Bbx

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_006522606.1 Gene:Bbx / 70508 MGIID:1917758 Length:937 Species:Mus musculus


Alignment Length:106 Identity:28/106 - (26%)
Similarity:46/106 - (43%) Gaps:10/106 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLKDKTEWEQKAIKMKEEYNKAVK 69
            |.:||::|::|:....|..:::::|........|...:.|..|..|.  :||...|.:||..|. 
Mouse    79 RARRPMNAFLLFCKRHRSLVRQEHPRLDNRGATKILADWWAVLDPKE--KQKYTDMAKEYKDAF- 140

  Fly    70 EYEANGG----TDSGAPKKRKKAAAKPAKK--AKKKESSEE 104
             .:||.|    ..:..|.|.......|.||  |...:||.:
Mouse   141 -MKANPGYRWCPTTNKPVKSPTPTVNPRKKLWAFPPDSSRD 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 16/64 (25%)
BbxXP_006522606.1 SOX-TCF_HMG-box 79..150 CDD:238684 20/74 (27%)
DUF2028 190..>322 CDD:312980
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.