DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and Hmgb4

DIOPT Version :10

Sequence 1:NP_726106.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_081312.2 Gene:Hmgb4 / 69317 MGIID:1916567 Length:181 Species:Mus musculus


Alignment Length:96 Identity:28/96 - (29%)
Similarity:49/96 - (51%) Gaps:9/96 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEYNKAV 68
            |::|.|:::|:..:....:|::||...|..:||..|::|...  .:|..:||||..|:.:|   .
Mouse    93 PRKPPSSFLLFSRDHYAMLKQENPDWTVVQVAKAAGKMWSTTDEAEKKPYEQKAALMRAKY---F 154

  Fly    69 KEYEANGGTDSGAPKKRKKAAAKPAKKAKKK 99
            :|.||......|    ||....:.||.:.|:
Mouse   155 EEQEAYRNQCQG----RKGNFLESAKTSLKQ 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_726106.1 HMG-box_SSRP1-like 8..72 CDD:438810 19/65 (29%)
Hmgb4NP_081312.2 HMG-box_HMGB_rpt1 8..76 CDD:438794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..100 3/6 (50%)
HMG-box_HMGB_rpt2 91..161 CDD:438795 22/70 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.