powered by:
Protein Alignment HmgZ and LOC681067
DIOPT Version :9
Sequence 1: | NP_001286694.1 |
Gene: | HmgZ / 37480 |
FlyBaseID: | FBgn0010228 |
Length: | 111 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006257578.1 |
Gene: | LOC681067 / 681067 |
RGDID: | 1584677 |
Length: | 168 |
Species: | Rattus norvegicus |
Alignment Length: | 72 |
Identity: | 22/72 - (30%) |
Similarity: | 42/72 - (58%) |
Gaps: | 5/72 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 DRPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLK--DKTEWEQKAIKMKEEYNK 66
|.|::|.|:::|:..:..|:||:.:|...|..:||..|.:|.... ||..:|::|..::.:|
Rat 91 DAPRKPPSSFLLFSQDHFEEIKEQHPNWTVGQVAKAAGRMWARCSEADKIPYEERAAVLRAKY-- 153
Fly 67 AVKEYEA 73
::|.||
Rat 154 -LEEREA 159
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.