DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and SOX4

DIOPT Version :10

Sequence 1:NP_726106.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_003098.1 Gene:SOX4 / 6659 HGNCID:11200 Length:474 Species:Homo sapiens


Alignment Length:105 Identity:31/105 - (29%)
Similarity:50/105 - (47%) Gaps:20/105 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLKDK------TEWEQKAIKMKEEY- 64
            |||::|:|:|....|.:|.:.:|.....:|:||.|:.|:.|||.      .|.|:..:|...:| 
Human    60 KRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYP 124

  Fly    65 ------NKAVKEYEANGGTDSGAPKKRKKAAAKPAKKAKK 98
                  .|.||...||..:.:.       |::||.:|..|
Human   125 DYKYRPRKKVKSGNANSSSSAA-------ASSKPGEKGDK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_726106.1 HMG-box_SSRP1-like 8..72 CDD:438810 23/76 (30%)
SOX4NP_003098.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58
HMG-box_SoxC 58..133 CDD:438838 21/72 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..228 10/37 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..286
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..416
9aaTAD. /evidence=ECO:0000269|PubMed:34342803 426..434
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.