DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment HmgZ and hmgxb4

DIOPT Version :9

Sequence 1:	NP_001286694.1	Gene:	HmgZ / 37480	FlyBaseID:	FBgn0010228	Length:	111	Species:	Drosophila melanogaster
Sequence 2:	NP_001025555.1	Gene:	hmgxb4 / 594948	XenbaseID:	XB-GENE-951781	Length:	554	Species:	Xenopus tropicalis

Alignment Length:	112	Identity:	35/112 - (31%)
Similarity:	58/112 - (51%)	Gaps:	21/112 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly     4 DRPKRP-LSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEYN 65
            ::||:. :|||.::..|.|..|..::||....:::|:..|:|:.|  |||..|:|||..::.:.|
Frog   357 EKPKKKNMSAYQVFSKEYRGSIIAEHPGIDFGELSKKLAEVWKQLPEKDKLAWKQKAQYLQHKQN 421

  Fly    66 KA----VKEYEANG-------GTDSGAPKKRKKA-------AAKPAK 94
            ||    ||...::.       |:.||.|...||:       :..|||
Frog   422 KAEATTVKRKSSSSESAARSKGSSSGLPSPNKKSPTSVVSFSTSPAK 468

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
HmgZ	NP_001286694.1	HMG_box	6..71	CDD:395407	26/71 (37%)
hmgxb4	NP_001025555.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	14..34
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	47..368		4/10 (40%)
		DUF4171	107..226	CDD:316308
		HMG-box	364..423	CDD:238037	20/58 (34%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	418..468		12/49 (24%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1641977at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.920