powered by:
Protein Alignment HmgZ and hmgxb4a
DIOPT Version :9
Sequence 1: | NP_001286694.1 |
Gene: | HmgZ / 37480 |
FlyBaseID: | FBgn0010228 |
Length: | 111 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005163967.1 |
Gene: | hmgxb4a / 559742 |
ZFINID: | ZDB-GENE-070912-675 |
Length: | 632 |
Species: | Danio rerio |
Alignment Length: | 67 |
Identity: | 24/67 - (35%) |
Similarity: | 40/67 - (59%) |
Gaps: | 3/67 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 DRPKRP-LSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEYN 65
|:||:. ::||.::..|.|..|..:.||....:::|:..|:|:.| |||..|.|||..::.:.|
Zfish 434 DKPKKKNMTAYQVFCKEYRVNINAEQPGLVFGELSKKLAEVWKQLPEKDKLVWRQKAQYLQHKQN 498
Fly 66 KA 67
||
Zfish 499 KA 500
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
HmgZ | NP_001286694.1 |
HMG_box |
6..71 |
CDD:395407 |
23/65 (35%) |
hmgxb4a | XP_005163967.1 |
DUF4171 |
121..262 |
CDD:290491 |
|
HMG-box |
441..500 |
CDD:238037 |
19/58 (33%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1641977at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.