DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and SOX18

DIOPT Version :10

Sequence 1:NP_726106.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_060889.1 Gene:SOX18 / 54345 HGNCID:11194 Length:384 Species:Homo sapiens


Alignment Length:98 Identity:22/98 - (22%)
Similarity:54/98 - (55%) Gaps:14/98 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLK--DKTEWEQKAIKMKEEYNKA 67
            |.:||::|:|:|..:.|:::.:.||......::|..|:.|:.|.  :|..:.::|.:::.::.:.
Human    84 RIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNAAEKRPFVEEAERLRVQHLRD 148

  Fly    68 VKEYEANGGTDSGAPKKRKKAAAKPAKKAKKKE 100
            ...|:..       |:::|:     |:||::.|
Human   149 HPNYKYR-------PRRKKQ-----ARKARRLE 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_726106.1 HMG-box_SSRP1-like 8..72 CDD:438810 14/65 (22%)
SOX18NP_060889.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..88 1/3 (33%)
HMG-box_SoxF_SOX18 82..161 CDD:438851 17/83 (20%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P43680 87..100 5/12 (42%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P43680 111..123 2/11 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..218 7/36 (19%)
Important for transcriptional activation. /evidence=ECO:0000250|UniProtKB:P43680 166..231 1/4 (25%)
Sox17_18_mid 197..245 CDD:463454
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..312
9aaTAD. /evidence=ECO:0000269|PubMed:17603017 325..333
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.