DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and RGD1561694

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_038948739.1 Gene:RGD1561694 / 498388 RGDID:1561694 Length:209 Species:Rattus norvegicus


Alignment Length:108 Identity:46/108 - (42%)
Similarity:66/108 - (61%) Gaps:7/108 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELW--RGLKDKTEWEQKAIKMKEEYNKAV 68
            ||||.||:.|:.:|.|.:||.::||..:.|.||:.||:|  :..|||..:||||.|:||:|.|.:
  Rat    95 PKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDI 159

  Fly    69 KEYEANGGTDSGAPKKRKKAAAKPAKKAKKKESSEEEEEDESE 111
            ..|.|.|.::.|     ||...:|....||.|..:||||:|.:
  Rat   160 AAYRAKGKSEVG-----KKGPGRPTGSKKKNEPEDEEEEEEED 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 31/66 (47%)
RGD1561694XP_038948739.1 HMG_box_2 6..78 CDD:401091
HMG_box 95..162 CDD:395407 31/66 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.