DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and Sox21b

DIOPT Version :10

Sequence 1:NP_726106.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_061509694.1 Gene:Sox21b / 4577582 VectorBaseID:AGAMI1_014325 Length:529 Species:Anopheles gambiae


Alignment Length:91 Identity:25/91 - (27%)
Similarity:46/91 - (50%) Gaps:13/91 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEYNKAVK 69
            |||::|:|:|....|.:|.:|||....::|:||.|..|:.|  .:|..:..:|.:::..:.|...
Mosquito   143 KRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEDEKRPFIDEAKRLRAMHMKEHP 207

  Fly    70 EYEANGGTDSGAPKKRKKAAAKPAKK 95
            :|           |.|.:...||.::
Mosquito   208 DY-----------KYRPRRKPKPIRR 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_726106.1 HMG-box_SSRP1-like 8..72 CDD:438810 19/65 (29%)
Sox21bXP_061509694.1 None

Return to query results.
Submit another query.