DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and hmgb2b

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001004674.1 Gene:hmgb2b / 447936 ZFINID:ZDB-GENE-040912-122 Length:214 Species:Danio rerio


Alignment Length:112 Identity:43/112 - (38%)
Similarity:65/112 - (58%) Gaps:6/112 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELW--RGLKDKTEWEQKAIKMKEEYNKAV 68
            ||||.||:.::.:|.|..:|.::|...:.:|||:.||||  :..||:..:||||.|::|:|.|.|
Zfish    97 PKRPPSAFFVFCSEYRPTVKSEHPNLTIGEIAKKLGELWSKQSSKDRAPFEQKAGKLREKYEKEV 161

  Fly    69 KEYEANGGTDSGAPKKR----KKAAAKPAKKAKKKESSEEEEEDESE 111
            ..|.|.||.....|.:.    ||:.|:......:.|..|:||:||.|
Zfish   162 AAYRAGGGASKRGPGRPTGSVKKSQAEADDDDDEDEDEEDEEDDEEE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 28/66 (42%)
hmgb2bNP_001004674.1 HMG_box_2 7..78 CDD:286146
HMG_box 97..164 CDD:278906 28/66 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.