DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and tHMG1

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster


Alignment Length:72 Identity:29/72 - (40%)
Similarity:49/72 - (68%) Gaps:3/72 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GDRPKRPLSAYMLWLNET-REQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEY 64
            |.|||:|:||:|||:|.| |:.||.::|...|.:::.:|||:||.:  :||..|::.|.....||
  Fly     5 GARPKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEY 69

  Fly    65 NKAVKEY 71
            .:.:|::
  Fly    70 KEKLKQW 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 27/67 (40%)
tHMG1NP_651055.1 HMGB-UBF_HMG-box 8..74 CDD:238686 26/65 (40%)
Herpes_U55 <55..>116 CDD:253772 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I3986
eggNOG 1 0.900 - - E1_COG5648
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I2031
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.