powered by:
Protein Alignment HmgZ and tHMG1
DIOPT Version :9
Sequence 1: | NP_001286694.1 |
Gene: | HmgZ / 37480 |
FlyBaseID: | FBgn0010228 |
Length: | 111 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_651055.1 |
Gene: | tHMG1 / 42650 |
FlyBaseID: | FBgn0038978 |
Length: | 126 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 29/72 - (40%) |
Similarity: | 49/72 - (68%) |
Gaps: | 3/72 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 GDRPKRPLSAYMLWLNET-REQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEY 64
|.|||:|:||:|||:|.| |:.||.::|...|.:::.:|||:||.: :||..|::.|.....||
Fly 5 GARPKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEY 69
Fly 65 NKAVKEY 71
.:.:|::
Fly 70 KEKLKQW 76
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
57 |
1.000 |
Domainoid score |
I3986 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
55 |
1.000 |
Inparanoid score |
I2031 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1641977at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.870 |
|
Return to query results.
Submit another query.