DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and sox17a

DIOPT Version :10

Sequence 1:NP_726106.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_989425.1 Gene:sox17a / 395066 XenbaseID:XB-GENE-484295 Length:383 Species:Xenopus tropicalis


Alignment Length:99 Identity:21/99 - (21%)
Similarity:54/99 - (54%) Gaps:14/99 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRG--LKDKTEWEQKAIKMKEEYNKA 67
            |.:||::|:|:|..:.|:::.:.||.....:::|..|:.|:.  |.:|..:.::|.:::.::.:.
 Frog    60 RIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQHMQD 124

  Fly    68 VKEYEANGGTDSGAPKKRKKAAAKPAKKAKKKES 101
            ...|:..       |::||:     .|:.|:.::
 Frog   125 HPNYKYR-------PRRRKQ-----VKRMKRADT 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_726106.1 HMG-box_SSRP1-like 8..72 CDD:438810 14/65 (22%)
sox17aNP_989425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..58
HMG-box_SoxF_SOX17 55..135 CDD:438850 17/81 (21%)
Sox17_18_mid 191..239 CDD:463454
9aaTAD. /evidence=ECO:0000250|UniProtKB:Q9H6I2 331..339
Required for transcriptional activity and interaction with ctnnb1. /evidence=ECO:0000250|UniProtKB:Q3KQ35 332..337
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.