DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and CG12104

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster


Alignment Length:113 Identity:29/113 - (25%)
Similarity:52/113 - (46%) Gaps:16/113 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLKDKTEWEQKAIK---MKEEYNKA 67
            |.:||:.:.|:..:|...||:.||...:..:......:|..| |:|:....|::   .|.||.:.
  Fly    76 PPKPLAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESL-DETQKNVYALRHEQEKREYVRL 139

  Fly    68 VKEY-----EANGGTDSGAPKKRKKAAA---KPAKKAKKKESSEEEEE 107
            ::.|     |:.|.:::.||    .|.|   .|.....|.||.|:.::
  Fly   140 MRGYRHQLSESEGTSEAEAP----PAVATNQPPPLVTTKLESVEDLQQ 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 17/67 (25%)
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 17/64 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.