DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and HMGB2

DIOPT Version :10

Sequence 1:NP_726106.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_002120.1 Gene:HMGB2 / 3148 HGNCID:5000 Length:209 Species:Homo sapiens


Alignment Length:108 Identity:47/108 - (43%)
Similarity:67/108 - (62%) Gaps:7/108 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELW--RGLKDKTEWEQKAIKMKEEYNKAV 68
            ||||.||:.|:.:|.|.:||.::||..:.|.||:.||:|  :..|||..:||||.|:||:|.|.:
Human    95 PKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDI 159

  Fly    69 KEYEANGGTDSGAPKKRKKAAAKPAKKAKKKESSEEEEEDESE 111
            ..|.|.|.:::|     ||...:|....||.|..:||||:|.|
Human   160 AAYRAKGKSEAG-----KKGPGRPTGSKKKNEPEDEEEEEEEE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_726106.1 HMG-box_SSRP1-like 8..72 CDD:438810 29/65 (45%)
HMGB2NP_002120.1 HMG-box_HMGB_rpt1 8..76 CDD:438794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..150 26/54 (48%)
HMG-box_HMGB_rpt2 93..163 CDD:438795 31/67 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..209 16/41 (39%)
Required for chemotactic activity. /evidence=ECO:0000269|PubMed:19811285 165..180 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.