DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and Hmgb3

DIOPT Version :10

Sequence 1:NP_726106.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001385705.1 Gene:Hmgb3 / 305373 RGDID:1564407 Length:241 Species:Rattus norvegicus


Alignment Length:108 Identity:47/108 - (43%)
Similarity:63/108 - (58%) Gaps:11/108 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLKD--KTEWEQKAIKMKEEYNKAV 68
            ||||.|.:.|:.:|.|.:||..|||..:.|:||:.||:|..|.|  |..:..||.|:||:|.|.|
  Rat   134 PKRPPSGFFLFCSEFRPKIKSANPGISIGDVAKKLGEMWNNLSDSEKQPYMTKAAKLKEKYEKDV 198

  Fly    69 KEYEANGGTDSGAPKKRKKAAAKPAKKAKKKESSEEEEEDESE 111
            .:|::.|..|         .|..|||.|:||...|||||:|.|
  Rat   199 ADYKSKGKFD---------GAKGPAKVARKKVEEEEEEEEEEE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_726106.1 HMG-box_SSRP1-like 8..72 CDD:438810 28/65 (43%)
Hmgb3NP_001385705.1 HMG-box_HMGB_rpt1 54..117 CDD:438794
HMG-box_HMGB_rpt2 132..202 CDD:438795 30/67 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.