DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and Bbx

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_008766856.1 Gene:Bbx / 303970 RGDID:1309769 Length:938 Species:Rattus norvegicus


Alignment Length:113 Identity:31/113 - (27%)
Similarity:50/113 - (44%) Gaps:17/113 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEYNKA 67
            |.:||::|::|:....|..:::::|........|...:.|..|  |:|.::...|.:.|:.:.||
  Rat    79 RARRPMNAFLLFCKRHRSLVRQEHPRLDNRGATKILADWWAVLDPKEKQKYTDMAKEYKDAFMKA 143

  Fly    68 VKEYE----ANGGTDSGAP--KKRKKAAAKP---------AKKAKKKE 100
            ...|.    .|....|..|  ..|||..|.|         |||||.:|
  Rat   144 NPGYRWCPTTNKPVKSPTPTVNPRKKLWAFPSDSSRDLPTAKKAKTEE 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 15/66 (23%)
BbxXP_008766856.1 SOX-TCF_HMG-box 79..150 CDD:238684 17/70 (24%)
DUF2028 191..>323 CDD:312980 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.