DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and Hmgb2

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_058883.1 Gene:Hmgb2 / 29395 RGDID:69291 Length:210 Species:Rattus norvegicus


Alignment Length:108 Identity:47/108 - (43%)
Similarity:66/108 - (61%) Gaps:7/108 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELW--RGLKDKTEWEQKAIKMKEEYNKAV 68
            ||||.||:.|:.:|.|.:||.::||..:.|.||:.||:|  :..|||..:||||.|:||:|.|.:
  Rat    95 PKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDI 159

  Fly    69 KEYEANGGTDSGAPKKRKKAAAKPAKKAKKKESSEEEEEDESE 111
            ..|.|.|.::.|     ||...:|....||.|..:||||:|.|
  Rat   160 AAYRAKGKSEVG-----KKGPGRPTGSKKKNEPEDEEEEEEEE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 31/66 (47%)
Hmgb2NP_058883.1 HMG_box_2 6..78 CDD:401091
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..102 5/6 (83%)
HMG_box 95..162 CDD:395407 31/66 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..210 16/41 (39%)
Required for chemotactic activity. /evidence=ECO:0000250|UniProtKB:P26583 165..180 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.