DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and Tox4

DIOPT Version :10

Sequence 1:NP_726106.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_775446.2 Gene:Tox4 / 286990 RGDID:708449 Length:619 Species:Rattus norvegicus


Alignment Length:73 Identity:23/73 - (31%)
Similarity:42/73 - (57%) Gaps:2/73 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DRPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEYNK 66
            :.|::|:|||.|:..:|:..||..||.:...:::|....:|..|  :.|..:::|....|:||.|
  Rat   221 NEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLK 285

  Fly    67 AVKEYEAN 74
            |:..|:.|
  Rat   286 ALAAYKDN 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_726106.1 HMG-box_SSRP1-like 8..72 CDD:438810 20/65 (31%)
Tox4NP_775446.2 NHP6B 140..>306 CDD:227935 23/73 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..227 1/5 (20%)
Nuclear localization signal. /evidence=ECO:0000255 213..218
HMG-box_TOX-like 224..293 CDD:438811 21/68 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..335
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 436..458
Peptidase_S21 <464..530 CDD:330753
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.