DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and SPBC28F2.11

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_595672.1 Gene:SPBC28F2.11 / 2540337 PomBaseID:SPBC28F2.11 Length:310 Species:Schizosaccharomyces pombe


Alignment Length:111 Identity:33/111 - (29%)
Similarity:55/111 - (49%) Gaps:17/111 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RPKRPLSAYMLWLNETREQIKKDNPGSK---VTDIAKRGGELWRGLK--DKTEWEQKAIKMKEEY 64
            :||||.|||.|:....|.:| |::.|.|   |.::.|...|.|..|.  |:..:|::|.|::|.|
pombe   116 QPKRPPSAYNLFQKNQRSEI-KESLGEKSNDVKEVNKAMHEKWGSLSEDDRKTYEEEASKLREAY 179

  Fly    65 NKAVKEYEANGGTDSGAPKKRKKAAAKPAKKAKKKESSEEEEEDES 110
            .:.:..|.|:           |:.|:....:...:|:|.:..||.|
pombe   180 EEEMAAYNAS-----------KENASVADSRVTAEETSTKPSEDLS 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 24/69 (35%)
SPBC28F2.11NP_595672.1 NHP6B <108..251 CDD:227935 33/111 (30%)
HMGB-UBF_HMG-box 117..184 CDD:238686 24/67 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.