DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and hmo1

DIOPT Version :10

Sequence 1:NP_726106.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_595672.1 Gene:hmo1 / 2540337 PomBaseID:SPBC28F2.11 Length:310 Species:Schizosaccharomyces pombe


Alignment Length:111 Identity:33/111 - (29%)
Similarity:55/111 - (49%) Gaps:17/111 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RPKRPLSAYMLWLNETREQIKKDNPGSK---VTDIAKRGGELWRGLK--DKTEWEQKAIKMKEEY 64
            :||||.|||.|:....|.:| |::.|.|   |.::.|...|.|..|.  |:..:|::|.|::|.|
pombe   116 QPKRPPSAYNLFQKNQRSEI-KESLGEKSNDVKEVNKAMHEKWGSLSEDDRKTYEEEASKLREAY 179

  Fly    65 NKAVKEYEANGGTDSGAPKKRKKAAAKPAKKAKKKESSEEEEEDES 110
            .:.:..|.|:           |:.|:....:...:|:|.:..||.|
pombe   180 EEEMAAYNAS-----------KENASVADSRVTAEETSTKPSEDLS 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_726106.1 HMG-box_SSRP1-like 8..72 CDD:438810 22/68 (32%)
hmo1NP_595672.1 HMG-box_SF 110..186 CDD:469606 24/70 (34%)

Return to query results.
Submit another query.