DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and Sox8

DIOPT Version :10

Sequence 1:NP_726106.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_035577.1 Gene:Sox8 / 20681 MGIID:98370 Length:464 Species:Mus musculus


Alignment Length:102 Identity:24/102 - (23%)
Similarity:49/102 - (48%) Gaps:15/102 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEYNKAVK 69
            |||::|:|:|....|.::....|.....:::|..|:|||.|  .:|..:.::|.:::.::.|...
Mouse   100 KRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQHKKDHP 164

  Fly    70 EYEANGGTDSGAPKKRKKAAAKPAKKAKKKESSEEEE 106
            :|:..       |::||..      |..:.:|....|
Mouse   165 DYKYQ-------PRRRKSV------KTGRSDSDSGTE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_726106.1 HMG-box_SSRP1-like 8..72 CDD:438810 16/65 (25%)
Sox8NP_035577.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Sox_N 18..86 CDD:463586
Dimerization (DIM). /evidence=ECO:0000250|UniProtKB:P57073 55..97
HMG-box_SoxE 98..172 CDD:438840 19/78 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..244 8/48 (17%)
Transactivation domain (TAM). /evidence=ECO:0000250|UniProtKB:P57073 221..299
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..315
Transactivation domain (TAC). /evidence=ECO:0000250|UniProtKB:P57073 347..464
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..374
9aaTAD. /evidence=ECO:0000250|UniProtKB:P57073 418..426
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 444..464
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.