DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and hmg-6

DIOPT Version :10

Sequence 1:NP_726106.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_493451.2 Gene:hmg-6 / 185946 WormBaseID:WBGene00009827 Length:128 Species:Caenorhabditis elegans


Alignment Length:69 Identity:22/69 - (31%)
Similarity:33/69 - (47%) Gaps:9/69 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLKDKTEWEQKAIKMKEEYNK------ 66
            |..|||.|:..|.:...|:..|.:....|:::....|..|   ||.|:||.|.:.|.|:      
 Worm    51 RSTSAYALFFRERQSLEKRAAPYATFGQISQKIARQWDSL---TEEEKKAYKQRCEKNRKTSIAN 112

  Fly    67 AVKE 70
            ||:|
 Worm   113 AVEE 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_726106.1 HMG-box_SSRP1-like 8..72 CDD:438810 22/69 (32%)
hmg-6NP_493451.2 HMG-box_SF 54..107 CDD:469606 18/55 (33%)

Return to query results.
Submit another query.