powered by:
Protein Alignment HmgZ and hmg-1.1
DIOPT Version :9
Sequence 1: | NP_001286694.1 |
Gene: | HmgZ / 37480 |
FlyBaseID: | FBgn0010228 |
Length: | 111 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001370073.1 |
Gene: | hmg-1.1 / 175081 |
WormBaseID: | WBGene00001971 |
Length: | 95 |
Species: | Caenorhabditis elegans |
Alignment Length: | 67 |
Identity: | 30/67 - (44%) |
Similarity: | 40/67 - (59%) |
Gaps: | 2/67 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLKDKTEWEQKAIKMKEEYNKAVKE 70
|||.:||:..|:.|.||:||| ||..|.|:||..|..|..|.||:.||:||...|:.|...:..
Worm 28 PKRAMSAFFFWMQENRERIKK--PGMGVADVAKAAGVEWGKLTDKSRWEKKAADDKKRYEVDIAN 90
Fly 71 YE 72
|:
Worm 91 YK 92
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
72 |
1.000 |
Domainoid score |
I6068 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
64 |
1.000 |
Inparanoid score |
I3963 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1641977at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000133 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
7 | 6.870 |
|
Return to query results.
Submit another query.