DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and hmg-1.1

DIOPT Version :10

Sequence 1:NP_726106.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001370073.1 Gene:hmg-1.1 / 175081 WormBaseID:WBGene00001971 Length:95 Species:Caenorhabditis elegans


Alignment Length:67 Identity:30/67 - (44%)
Similarity:40/67 - (59%) Gaps:2/67 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLKDKTEWEQKAIKMKEEYNKAVKE 70
            |||.:||:..|:.|.||:|||  ||..|.|:||..|..|..|.||:.||:||...|:.|...:..
 Worm    28 PKRAMSAFFFWMQENRERIKK--PGMGVADVAKAAGVEWGKLTDKSRWEKKAADDKKRYEVDIAN 90

  Fly    71 YE 72
            |:
 Worm    91 YK 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_726106.1 HMG-box_SSRP1-like 8..72 CDD:438810 27/63 (43%)
hmg-1.1NP_001370073.1 HMG-box_SF 15..91 CDD:469606 29/64 (45%)

Return to query results.
Submit another query.