DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and hmg-3

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_491688.1 Gene:hmg-3 / 172250 WormBaseID:WBGene00001973 Length:689 Species:Caenorhabditis elegans


Alignment Length:113 Identity:40/113 - (35%)
Similarity:62/113 - (54%) Gaps:7/113 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DRPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLK--DKTEWEQKAIKMKEEYNK 66
            :.|||..:||::|.|..|..:|:|  |..:.|:||:.|..|:.:.  ||.||..||.:.|..|..
 Worm   559 NEPKRATTAYIIWFNANRNSMKED--GDTLGDVAKKAGAKWKSMSADDKKEWNDKAAQDKARYEA 621

  Fly    67 AVKEYEANGG--TDSGAPKKRKKAAAKPAKKAKKKES-SEEEEEDESE 111
            .:|||:.|||  ..:..|..:|.:...|.|:.|.||. |:.::.|:.|
 Worm   622 EMKEYKKNGGGVEKASGPSTKKSSDQSPGKQFKSKEHISDTDDSDDDE 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 25/66 (38%)
hmg-3NP_491688.1 POB3 20..497 CDD:227494
SSrecog 75..285 CDD:281523
PH2_SSRP1-like 332..429 CDD:270051
HMGB-UBF_HMG-box 561..624 CDD:238686 24/64 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160105
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.