DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and Hmgb1

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001300823.1 Gene:Hmgb1 / 15289 MGIID:96113 Length:215 Species:Mus musculus


Alignment Length:108 Identity:46/108 - (42%)
Similarity:68/108 - (62%) Gaps:5/108 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWR--GLKDKTEWEQKAIKMKEEYNKAV 68
            ||||.||:.|:.:|.|.:||.::||..:.|:||:.||:|.  ...||..:|:||.|:||:|.|.:
Mouse    95 PKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDI 159

  Fly    69 KEYEANGGTDSGAPKKRKKAAAKPAKKAKKKESSEEEEEDESE 111
            ..|.|.|..|:.   |:....|:.:||.|::|..||:||||.|
Mouse   160 AAYRAKGKPDAA---KKGVVKAEKSKKKKEEEDDEEDEEDEEE 199

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 29/66 (44%)
Hmgb1NP_001300823.1 Sufficient for interaction with HAVCR2. /evidence=ECO:0000269|PubMed:22842346 1..97 1/1 (100%)
Heparin-binding. /evidence=ECO:0000250|UniProtKB:P10103 1..10
LPS binding (delipidated). /evidence=ECO:0000250|UniProtKB:P09429 3..15
HMG_box_2 6..78 CDD:401091
NLS 1. /evidence=ECO:0000250|UniProtKB:P63159 27..43
Nuclear localization signal (NLS) 1. /evidence=ECO:0000250|UniProtKB:P63159 27..43
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..95 46/108 (43%)