| Sequence 1: | NP_726106.1 | Gene: | HmgZ / 37480 | FlyBaseID: | FBgn0010228 | Length: | 111 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_320213.4 | Gene: | Ssrp / 1280366 | VectorBaseID: | AGAMI1_014024 | Length: | 728 | Species: | Anopheles gambiae |
| Alignment Length: | 155 | Identity: | 61/155 - (39%) |
|---|---|---|---|
| Similarity: | 83/155 - (53%) | Gaps: | 51/155 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLKDKTEWEQKAIKMKEEYNKAVKE 70
Fly 71 YEANGGTDSGAPK--KRKKAAAKPA---------------------------------------- 93
Fly 94 ---KKAKKKES------SEEEEEDE 109 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| HmgZ | NP_726106.1 | HMG-box_SSRP1-like | 8..72 | CDD:438810 | 35/63 (56%) |
| Ssrp | XP_320213.4 | POB3 | 20..494 | CDD:227494 | |
| HMG-box_SSRP1-like | 569..633 | CDD:438810 | 35/63 (56%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||