DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and HMGB4

DIOPT Version :10

Sequence 1:NP_726106.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_660206.2 Gene:HMGB4 / 127540 HGNCID:24954 Length:186 Species:Homo sapiens


Alignment Length:98 Identity:25/98 - (25%)
Similarity:51/98 - (52%) Gaps:6/98 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLKD--KTEWEQKAIKMKEEYNKAV 68
            |:||.|:::|:..:...|:|::||...|..:||..|::|....|  |..:||:...::.:|.:.:
Human    93 PRRPPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQRVALLRAKYFEEL 157

  Fly    69 KEYEANGGTDSGAPKKRKKAAAKPAKKAKKKES 101
            :.|.    ....|.||.:.:|....:..:.::|
Human   158 ELYR----KQCNARKKYRMSARNRCRGKRVRQS 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_726106.1 HMG-box_SSRP1-like 8..72 CDD:438810 18/65 (28%)
HMGB4NP_660206.2 HMG-box_HMGB_rpt1 8..76 CDD:438794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..98 3/4 (75%)
HMG-box_HMGB_rpt2 91..161 CDD:438795 19/67 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.