DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and LOC108350839

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_017448593.1 Gene:LOC108350839 / 108350839 RGDID:11440908 Length:214 Species:Rattus norvegicus


Alignment Length:107 Identity:46/107 - (42%)
Similarity:67/107 - (62%) Gaps:8/107 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELW--RGLKDKTEWEQKAIKMKEEYNKAVK 69
            |||.||:.|:.:|.|.:||.::||..:.|:||:.||:|  ..:.||...|:||.|:||:|.|.:.
  Rat    96 KRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWTNTAVDDKQPCEKKAAKLKEKYEKDIA 160

  Fly    70 EYEANGGTDSGAPKKRKKAAAKPAKKAKKKESSEEEEEDESE 111
            .|.|.|..|:.     ||...| |:|:|||:..|::||||.|
  Rat   161 AYRAKGKPDAA-----KKGVVK-AEKSKKKKEEEDDEEDEDE 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 28/65 (43%)
LOC108350839XP_017448593.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.