DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and HMG20B

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_006330.2 Gene:HMG20B / 10362 HGNCID:5002 Length:317 Species:Homo sapiens


Alignment Length:99 Identity:30/99 - (30%)
Similarity:52/99 - (52%) Gaps:9/99 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLK--DKTEWEQKAIKMKEEYNKAV 68
            ||.|::.|:.:|||.||||:..:|.....:|.|..|..|..|:  :|..:..:|.:.|::|.|.:
Human    70 PKAPVTGYVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPTEKQRYLDEAEREKQQYMKEL 134

  Fly    69 KEYEANGGTDSGAPKKRKKAAAKPAKKAKKKESS 102
            :.|:.:........|.::       ||.||::||
Human   135 RAYQQSEAYKMCTEKIQE-------KKIKKEDSS 161

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 22/66 (33%)